DPCstruct | MC9947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | CL0123- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E2XW08 | 134-226 | ELDAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKATSEKLYKDVQSYRLITVATLVDRLKINGSLARKALSDLEEKGQIKKVVGHS… |
| A0A5C9E639 | 3-83 | RKKWGRSTTKTEKVIREAIPKKEVLKEIDDYLVKASSVTPYDLANKFNIRMSVARKILREKEEEGIIVPYIRESGFVVYTT |
| A0A226NSC7 | 192-284 | None |
| A0A2G3AT25 | 211-299 | None |
| A0A836BFB8 | 2-103 | None |
| A0A7R8X098 | 962-1051 | None |
| Q98RQ8 | 2-86 | None |
| A0A0D9XP62 | 1081-1183 | None |
| A0A368FX06 | 14-114 | None |
| A0A1Q9EFP5 | 130-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.