DPCstruct | MC9946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319EFA2 | 11-211 | LADYDINESALNVPRHLEPIMPDGIRYELNRCLHMAIQVLEARERYRPRFDQMYAERFDYLCSAEGDIYEQHKASVRAILSWTPPMK… |
| A0A1D2JMR7 | 276-494 | MIETPGPYLFYKHKHPLPKHLLSVMPAPYRHAAIEAERTGGASFSRFRFLQSIFGEHYYYTASPNDLESFNKHKASVHRLLNWKVQR… |
| A0A0U5FQJ4 | 2-235 | None |
| B8NBS1 | 616-830 | None |
| A0A507QRH6 | 7-208 | None |
| A0A3D8SW34 | 65-275 | None |
| A0A1L9THD3 | 3-202 | None |
| D4DDY3 | 123-326 | None |
| A0A7R8APF4 | 12-229 | None |
| A0A0J8QU88 | 67-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.