DPCstruct | MC9945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06967 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3UBK0 | 2-75 | LNQLRSYLDRIEINDPKLAQFICQLIPDRCPFERKLYVFDYCIQIPALCKLNPLYRQLLNLRLKSLMCLMRSSD |
| A0A2N6K3Q4 | 4-82 | ILNKMRLWLDSFEVRDRKIAYFLCKLIPSQCPFERDIKLFGHTLCHLPPLCKLNPLYEQLVGLRLQALCYLAGEYKHIT |
| H1WIK2 | 8-83 | None |
| A0A1Q4R7F8 | 12-85 | None |
| A0A3C0NIM1 | 1-59 | None |
| A0A2S6VHD4 | 9-68 | None |
| A0A6N8G2E9 | 35-123 | None |
| A0A2D5LG03 | 117-183 | None |
| A0A2Z5X625 | 18-97 | None |
| A0A1Z4TVX1 | 55-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.