DPCstruct | MC9941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6SSG3 | 69-131 | APADLVKEGAHFDLPIALGLMTAMGVLPADSVDEYLVLEELSLDGSIQPVTGTLPAALNAAAQ |
| W4USA5 | 3-73 | TTNLVVNMAPADIRKEGSAYDLPLAIGLLGASETISSEKFSRYLVMGELSLDGSIQPIKGALSIAIKAREA |
| A0A0F3PG44 | 23-98 | None |
| A0A4Q8Y9V9 | 9-79 | None |
| A0A377C9T1 | 20-78 | None |
| A0A2D4RT22 | 1-65 | None |
| A0A0G0EZ19 | 1-64 | None |
| T1X4Y4 | 52-125 | None |
| A0A832UWU5 | 15-87 | None |
| A0A6J4NPC0 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.