DPCstruct | MC994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 213 ± 24 aa |
| Standard deviation of domain lengths | 24.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6CNL7 | 286-521 | AAKAEKQKRFEQAVEKLRKCRSDSPFSGYSGCSYLTAVYDNDFTLAMDIEYQSSAPYRLGWMGEANAEMARMFGDLYGSEEQLNQDL… |
| A0A5S3XCT3 | 3-228 | ELELIAYRKRVGDGPLEADDDGAVYINALYRNDMQIIAEEDKKFERAMVEATEPLLNSGVIELTSLFMGRQSDPQAIKQEMRDSLKG… |
| A0A2E6LSP7 | 304-507 | None |
| A0A355SL70 | 413-604 | None |
| A0A2D6TWT8 | 133-342 | None |
| V5C237 | 5-213 | None |
| A0A7X2ZXD3 | 2-219 | None |
| Q28QS2 | 388-616 | None |
| A0A5K7ZTL9 | 655-882 | None |
| A0A1M6NYH8 | 428-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.