DPCstruct | MC9938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256XM95 | 33-140 | ENIEKIVKTSVYHREISFDSIVLIVDQKVNDENIINTLKEKYSVREVIIITKEQLSNILVSFGSHERMFLGLGILIHFDPTSFKGKV… |
| A0A7J4DUX2 | 10-115 | VRVVAASETNDTINIVVEQYPRQQAIDELISKKAKHVYVHVVGDEVNVLAGIIGPNGKEEAIGIVKEIDYTNMKMKIVTPYQGEIKA… |
| A0A7J3QSG6 | 522-637 | None |
| A0A3M1QVI0 | 7-110 | None |
| A0A662VBG0 | 153-269 | None |
| A0A662U9T9 | 84-201 | None |
| A0A0S6W5E3 | 224-358 | None |
| A0A0P9EGU2 | 32-147 | None |
| A0A1F4QMR1 | 1-124 | None |
| A0A3D8P3W6 | 240-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.