DPCstruct | MC9937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 19.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.69 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0209- CL0010- PF01984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IK25 | 3-87 | RRQEMEEQKRVMLAQILTPGARERLSRVKLVKPERAAMVENHLIRSAQGGQLRGKVDENGLRGLLTQVSTQESKPKVTYRRRRVF |
| A0A7J4DUL1 | 14-123 | DEELEEIKRRKLLELQRRLLEEEARRKAEEEARARREALLRRILTPKARERLANVRLVRPEIAQLVEDQIIALVQAGRLAPPVDEDT… |
| A0A848E655 | 5-96 | None |
| A0A654GL14 | 76-191 | None |
| A0A1A9AJA8 | 7-132 | None |
| A0A0D3CEL5 | 99-214 | None |
| A0A0E0HHQ2 | 27-161 | None |
| A0A7J6LTZ2 | 4-120 | None |
| A0A6V7WPH2 | 6-98 | None |
| A0A2A5NY23 | 55-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.