DPCstruct | MC9933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 672 |
|---|---|
| Mean domain length (aa) | 251 ± 52 aa |
| Standard deviation of domain lengths | 52.07 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.97 |
| Pfam Score | 95.12 |
| Assigned Pfam label(s) | CL0023- CL0181- PF08370- CL0192- CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4CMQ3 | 2-183 | LFATFYVMRLSSSIIVKEENERTVDFVLSKPISRRRYVFEKILLVSINLVIYDGVIALSLLYMFDKYKIKPFDIVQFWYIVLSFVAV… |
| A0A7V4AYS2 | 15-246 | MKRFFREKSRLITSIVTPLLWILVFGSGLRGAAFGAGGADYRIFIFPGILGMSLLFTSMFTGVSVIWEREFGFLREVLVAPVSRAGI… |
| A0A1K2E5T4 | 82-272 | None |
| A0A2G4FLA2 | 101-407 | None |
| A0A2P8G161 | 9-273 | None |
| A0A7R9LRR6 | 1-157 | None |
| A0A7R9PYF5 | 391-711 | None |
| A0A7R9Q293 | 351-645 | None |
| A0A7R9Q4M5 | 119-413 | None |
| A0A7R9Q774 | 97-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.