DPCstruct | MC9932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5BQE6 | 1-76 | MDIYCGQLGMVTQLTYCVSMNEGLPCRNVIGCWETRVDIMALLKGVFTEEELRKCFSGLPKSRLDRIMEILRAIDK |
| A0A7V4AY59 | 5-77 | QFDGMQFWRCPQLGGGVPFSHCRKTNDALPCPRIIECWGRKLDMPRFLAENYSEEELKKALKPSGSRLATIFE |
| A0A1V5DMU3 | 19-100 | None |
| A0A445MRJ2 | 39-114 | None |
| A0A1F9A037 | 5-83 | None |
| A0A661JVS5 | 2-69 | None |
| A0A496YG55 | 10-81 | None |
| A0A1V5DY52 | 16-81 | None |
| A0A7X9JW72 | 17-97 | None |
| A0A496ZIQ5 | 145-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.