DPCstruct | MC9931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 186 ± 14 aa |
| Standard deviation of domain lengths | 13.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4AY16 | 26-234 | LHKLSMVAVVALAVSIPFLWHFDTSLKGMPLRNEPVQAPKSADRTRAVLIIDGNRDNYVAEFKHAQHQEMLGGEESCAKCHHIDKPN… |
| A0A7V0SF49 | 28-205 | LSMAAVVACAVIFASAFYRNAPAEPVKGALGWETMRLDGDRDGFYVEFSHQAHSAMPKEGCVYCHHLSMPDDSVTPCSRCHRDMKGP… |
| A0A1F7RTR0 | 285-496 | None |
| A0A7V1N6S1 | 140-325 | None |
| A0A7C4HNJ1 | 108-304 | None |
| A0A7C4HHL8 | 16-190 | None |
| A0A0S8A031 | 4-170 | None |
| A0A7V2YZI2 | 77-275 | None |
| A0A257VCV2 | 423-592 | None |
| A0A523YTK9 | 1-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.