DPCstruct | MC9930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11950 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4AWY6 | 9-99 | QDPQPAPPAPKEVRVNMSDEVRDGNYANFVRIQHTAMDFRLDFAKAVPDENMLNMVARLFMSPIHTKMFLKALEDNIMKYEAQFGPI… |
| A0A1F2WVT8 | 8-73 | GVYANSLMVQHTGQEFILDFAMMTGGTGQVVARVITSPGHMKRVVQAMEENIKRYEAAHGPIVPPP |
| A0A2G9LVZ5 | 5-102 | None |
| A0A0G0NES3 | 35-117 | None |
| A0A256ZKC5 | 5-105 | None |
| A0A367I2N1 | 14-110 | None |
| A0A5K7ZJ40 | 25-108 | None |
| A0A7X2PT35 | 3-87 | None |
| A0A3A4U7L6 | 63-142 | None |
| A0A3N5PJK9 | 19-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.