DPCstruct | MC993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 133 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13957 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9DKP4 | 1-134 | MAAVQTASLFRALPGWENHKTTFEDYKLRGVLPDFYGRDAALSLPDIHHIHLAQTTELAQHWARRYPTHERQHLRTTRIGDPDNDFW… |
| A0A5S3X8Y3 | 2-131 | EVSLTFSASLEAGMKKIGHDLEPLEKDLKTYFTTQEKPSYLGKDAPFFRPDNIEESEVHHLHLYIEGISCPDKWEKNKTSDSYIVYT… |
| A0A839INZ4 | 6-103 | None |
| A6VYA2 | 14-168 | None |
| A0A3T0VNT0 | 16-148 | None |
| A0A822MRW2 | 3-145 | None |
| A0A454B3J1 | 1-94 | None |
| A0A6B9G3E4 | 12-126 | None |
| A0A6G6AQH7 | 12-161 | None |
| A0A014NBM0 | 5-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.