DPCstruct | MC9928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 34.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 95.74 |
| Assigned Pfam label(s) | CL0286- PF02807- CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4AVA1 | 192-405 | MGAQHRAAVEKHVSDILWQSGAASRRMLHTWRLSPLQRLALERRHFHKALAVDSILVLHKEPGRMILINDEDHLCFVSHGQETNPAQ… |
| A0A2P0XIY9 | 1-122 | MQMGGDLGQVYRRLVTAVNDIEKRIPFSHDDRLGFLTFCPTNLGTTVRASVHIKVPKLAADKAKLEEVAGKYNLQVRGTRGEHTEAE… |
| A0A7S4PGS4 | 176-403 | None |
| A0A2G8LAS7 | 2-144 | None |
| A0A2G8LKB0 | 198-423 | None |
| A0A086KW13 | 538-796 | None |
| A0A671U9K2 | 2-160 | None |
| A0A7S1GCG4 | 1-145 | None |
| A0A7C5MY76 | 3-170 | None |
| T1GFR8 | 27-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.