DPCstruct | MC9927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 24.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0327- CL0645 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3XFI0 | 5-155 | RFKMLLSAYVDGEVAPGERTEIESHLTTCQGCSTELSRLRRLKDLFSHLEVKEPAPGFRDRLQARLEAAQRGTPFWNRLKTWILEQF… |
| A0A5S9IIH8 | 1-118 | MECNKIKDILDAYILGALENEENNKVKQHIQHCTECKKYHDESVRSWQKLQNLPTVSPSVSYADRIIKNHRRGKRIMQWTISTVFIL… |
| A0A162MTQ9 | 22-155 | None |
| A0A2D6PP08 | 7-154 | None |
| A0A3D1R2N7 | 3-120 | None |
| A0A1C6G7Y8 | 1-162 | None |
| A0A7V3HHE6 | 24-218 | None |
| A0A7X6C8P8 | 38-194 | None |
| A0A3A0CCZ7 | 1-169 | None |
| A0A661NZ57 | 10-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.