DPCstruct | MC9921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9RC90 | 115-248 | SGNCEFVKSLENVDLSKVFKDLQLVEDSYLTVLCKQTSENPLELPNDWTGLFPRSLFKVGQTKDEKELLEISMKVTSIYSVGELKKY… |
| V9R9A1 | 9-127 | DILWTLRSINPDSYVKVDCDNTDKSTDSPFTANWAGLFPNVLFTNLNSLTMGKKIEIKENTESLEESKNYRTTFSGANFYSPVIGEW… |
| A0A328PRC8 | 48-176 | None |
| A0A328PLN4 | 104-231 | None |
| A0A328PJA7 | 5-90 | None |
| A0A328PIT0 | 118-245 | None |
| A0A328PIL2 | 2-114 | None |
| A0A328PJE0 | 144-285 | None |
| V9RBY8 | 2-139 | None |
| V9RBQ2 | 41-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.