DPCstruct | MC992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 100 ± 17 aa |
| Standard deviation of domain lengths | 16.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.96 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0103- PF21307 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1C7F9 | 405-499 | LWYRQPAKVWVEALPVGNGRLGAMVYGGAAQEHIQFNEDSLWTGQPNEYQHEGAAKFLPELRRLLAEGKQKEAHELGMKEFMSIPLR… |
| A0A2V8HDJ2 | 34-137 | PAQAVAFGADAGPPTRPLTLWYRRPATQWVEALPIGNGRLGGMIFGDVVHERIQLNEDTLWAGGPYAPENPDALAALPLVRQLIFSG… |
| A0A7K3IVC6 | 35-131 | None |
| A0A6N7W3D5 | 9-105 | None |
| J0V1X8 | 1-66 | None |
| A0A6N1DSZ4 | 1-161 | None |
| A0A1H7G1C9 | 503-595 | None |
| A0A413LD49 | 18-112 | None |
| A0A542IQS4 | 2-80 | None |
| A0A815VHS1 | 109-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.