DPCstruct | MC9919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6RZS8 | 1-64 | MGVIMIKCPRTGRAINTGMKSDRETFRRSTVFFSRSYCTSCRTNHEWFAREAWVHEPEQELRKA |
| A0A3S5CYS3 | 1-63 | MKVVTVRCPYRGRAVSTGIEIEDAEFARLPDTLLVTRCPLCGLEHVVWTSEAWLEPVRYDRSA |
| A0A4Y3ZMX9 | 52-121 | None |
| A0A536STB8 | 1-52 | None |
| A0A537N7X1 | 1-59 | None |
| A0A7S7TM80 | 1-64 | None |
| M4Z9R8 | 30-89 | None |
| A0A7Y9IE50 | 1-57 | None |
| A0A327K5Y2 | 63-127 | None |
| A0A1N6LFF9 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.