DPCstruct | MC9915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327JVZ5 | 2-84 | FTGSPGGGKPDSPSCTSCHGGDPRQGGHSRAGKPIAPLAPSVVPTRLTDAADVAKWLRRNCAEVLGRDCTAAEKADLVAFLIS |
| A0A7M1B7J2 | 40-111 | SCASCHTNDLTKTGENIFTGKKIKPLSPKVNPKRFTNVKKVKKWLRRNFKDVYKREGTALEKGDVLYFMMGV |
| A0A011P195 | 227-311 | None |
| A0A1G1D8X7 | 1-66 | None |
| A0A2N2S6U3 | 69-139 | None |
| A0A7Y3JLM6 | 1-70 | None |
| B1XSM1 | 37-117 | None |
| A0A512H3M4 | 217-301 | None |
| A0A2N1CUC0 | 64-133 | None |
| A0A259DEP5 | 19-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.