DPCstruct | MC9912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 177 ± 23 aa |
| Standard deviation of domain lengths | 23.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9DHM8 | 24-198 | EQVYSEFDDEMKTLQEQIDSLTQENEALRAENAGLHSKFGEMDKRPALVMGDEEDLYPGEIKELVLSVLADKLERRVAKRSRRSEVF… |
| A0A1H6HQ27 | 18-186 | DNTIDMLNIDIEVLKEENERLQKIIDERARGQTVSLNDGLISRGQEADLYPNEVREILMDVLKAARANIVKDGTRRADVVDDILKAN… |
| A0A3D1UPY6 | 1-128 | None |
| R5ECV1 | 20-155 | None |
| A0A3C0TZR3 | 68-253 | None |
| A0A286E496 | 127-335 | None |
| A0A1C6J9U0 | 236-421 | None |
| A0A350IYL4 | 462-634 | None |
| A0A6N3UVL0 | 308-479 | None |
| A0A1U7J586 | 228-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.