DPCstruct | MC9911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q9FGT7 | 1-115 | MKKTNKLIGQSGVIGEENNRQTMFLIFTSRKTNNPLHCISLGSSGTGKTHLQSKVSELIPEEDKVEITVLSANAFYYFNRTELQHKL… |
| A0A1V9EBS5 | 34-126 | RTNELIGQIGVIGEENNRLLMYLVFTSRKREGPLHVISLGSSGMGKTHLQEKVGELMPVEDVIQITSLSENALYYFGKQELRNKLIL… |
| A0A5K7YVY4 | 26-128 | None |
| A0A4Z0FJU6 | 403-498 | None |
| A0A656QJX9 | 268-371 | None |
| A0A3E1NJ27 | 130-217 | None |
| A0A379LQ17 | 389-502 | None |
| A0A2D0KIR0 | 394-503 | None |
| A0A7V8XLQ3 | 46-138 | None |
| A0A0P9RP74 | 148-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.