DPCstruct | MC9910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 27 aa |
| Standard deviation of domain lengths | 27.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6QYE1 | 471-581 | PTKYIEQFMYELLETPQQYRNDINVNYSDYTSDWNITGKNIDWKNSRVNTTYGTRRINAYQIIEKTLNLKDVQIFDNVINSDGKEER… |
| A0A1L5L2W7 | 11-123 | PVDVVKDFMVELLEPSWNAAAVMEVIYVSYTGQWNITNKAKGAAANVKANETYGTERINGFHILEASLNMRTVKVYDTKYDAVSCRE… |
| A0A1A0DA13 | 111-257 | None |
| A0A3D2GXL3 | 184-343 | None |
| A0A6D2C1Q0 | 285-448 | None |
| A0A8A4I3Z9 | 434-524 | None |
| A0A7Y4U8H4 | 606-767 | None |
| A0A4R1WVY9 | 536-636 | None |
| R9L4F7 | 19-191 | None |
| A0A7T8ZWM5 | 387-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.