DPCstruct | MC991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 157 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9FHV6 | 2-142 | RDSLWLYPAVETVHLLGLATLVGCAAAFDLRLLGVSPRLPARATGHHLLRCARGGFAVAAVSGILLFTSDPVAIAGNPAFRWKLGFI… |
| A0A2V8H1T1 | 8-167 | LHNLMRWMADTRWSVDLHESRYAYSIVESIHVWTLCLFVGFAILLDLRLLGVTLKSVPMSQITTRILPWTKAAFVLMVISGLLLFFA… |
| A0A812R4C8 | 679-842 | None |
| A0A7Y1ZFR4 | 23-190 | None |
| A0A2V8MTE7 | 166-311 | None |
| A0A3E0NPE2 | 18-180 | None |
| A0A537UU59 | 265-410 | None |
| A0A2V5CFR9 | 25-178 | None |
| A0A2V5C1R4 | 12-185 | None |
| A0A2E8K8T0 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.