DPCstruct | MC9909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9A7S2 | 1-98 | MKHVLPALLAALLLGACTATPPPSVGYGRYLEPIPGSITYGGQPRTKLTKAPVGSIVPHQFFDNFGHRVYETYVIEPDRSLRLVGRR… |
| A0A246T8J1 | 1-77 | MRYAAIFIAMALAGCSTTGPPPEPIPGSLTYGRVARSPYPPGTVINNTFLGKWGYRRFEQYVVQPDGTLKLTFQQTA |
| A0A7W5PLU4 | 205-296 | None |
| A0A2V4WIG9 | 1-86 | None |
| A0A2J0YXS6 | 51-143 | None |
| A0A839DSD2 | 182-256 | None |
| A0A4R3GJW5 | 1-92 | None |
| A0A0Q6ZYY6 | 11-78 | None |
| A0A7W9Y3X5 | 13-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.