DPCstruct | MC9907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 124 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6FTE8 | 1-107 | MGFGRPPKTTRWQKGQSGNPNGRPKSKSEMMMDAANILNQPIDARTPDGQTVKLDGIEAAYLALCKKGLKGHKASLLEAIRIMLEVG… |
| A0A1Z8Q0A7 | 3-120 | QGDTDKIGYKNPPKNTQWKKGQSGNPNGRPKKSDNPATLDDFYDDFLEMLDEKAVVKMNDELVTLPYEKIIMNKLISKAMKGDHKSI… |
| A0A7V9YKB3 | 2-126 | None |
| A0A258KVX6 | 6-118 | None |
| A0A7Y6W348 | 1-106 | None |
| A0A4P1KDW1 | 1-129 | None |
| A0A4E0QHW5 | 2-132 | None |
| A0A327L1S6 | 35-159 | None |
| A0A848ELL4 | 8-121 | None |
| A0A0B1ZHQ9 | 9-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.