DPCstruct | MC9905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 556 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.57 |
| Pfam Score | 23.55 |
| Assigned Pfam label(s) | PF08346- PF09669- PF10543- PF03374- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3TS46 | 1-143 | MSNQLTFQNVALTAIQRNNQIYISAKDLASALQYKCVQSIANIYNSNSDEFTTEMSFVIDSVTNGINGSERKIRQRIFSLRGCHLIA… |
| A0A077Q0F5 | 2-89 | FFAVGLAESLGYTNPSKALKDHCKHLIKLNYNESLELGLGENLRGVILAGQSDMFRLVMRSNLPSAERFQDWVFESVLPSIMETGSYS |
| A0A636K3H1 | 97-248 | None |
| A0A1J0GJM5 | 4-137 | None |
| A0A6N0LXG9 | 23-135 | None |
| R6XV64 | 4-112 | None |
| A0A7W6EFF1 | 160-305 | None |
| A0A0G1FQP8 | 3-115 | None |
| A0A8B4D527 | 4-127 | None |
| A0A8B4D7J6 | 11-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.