DPCstruct | MC9904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3TMP6 | 1-82 | MSIEIDGSIIDNRDCTAEINRIYPSQIEAEEALAYFVKKARSTESEPCIISSEIKAVDGGFELIASFTFQYQAETMIFQLAT |
| A0A143I5B0 | 1-62 | MFTTRAEAEETLTALSKRARDVESDPCEIKSTFTEVEGGVKLDIDFVFACEAETLIFQLGLR |
| Q7VKK6 | 47-136 | None |
| A0A142B822 | 3-77 | None |
| A0A209APT8 | 1-94 | None |
| A0A377DGV8 | 26-94 | None |
| A0A377D1Q2 | 6-86 | None |
| A0A081NKI6 | 17-94 | None |
| A0A081KD29 | 34-110 | None |
| D4E3H1 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.