DPCstruct | MC9902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 178 ± 26 aa |
| Standard deviation of domain lengths | 25.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 70.59 |
| Assigned Pfam label(s) | PF09282- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H8TZE6 | 1-178 | MAHQYLDQTSAILKDDKGYFVPATQRKDGTWRKERRLKENYIPQDEVALYESKGKKFAANKPKLPPGAPVEMVAVPKQQQQTKKVLT… |
| A0A7S1J965 | 5-216 | FREKRVAGGTLHDGSEYEIIQGSLRPDGTRRPDIKVRKGYVAQDEVRAMETKGSRHRAVQEEVKHWVPGMSNEMHQKQKELAQKVKD… |
| A0A819X1H6 | 855-1016 | None |
| A0A7J0ESM6 | 27-211 | None |
| S4RMC8 | 8-182 | None |
| A0A5N6EGI6 | 79-274 | None |
| A0A6P5GD23 | 9-220 | None |
| A0A3P6HV58 | 35-211 | None |
| A0A0M8MWW8 | 9-149 | None |
| R1DBD3 | 5-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.