DPCstruct | MC9901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 197 ± 27 aa |
| Standard deviation of domain lengths | 26.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 85.62 |
| Assigned Pfam label(s) | PF08685- CL0692- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9QIN7 | 18-210 | TCQEVHERIPIAPDGNYLLTGGGRLFTVYCAGMKSAPSEYITLAKTGQAANFSQYTAGGASPGTNVRTAFTRLRIDPAAFTVDIGDL… |
| A0A2H8TS69 | 704-928 | CDWAARPPRKRKCNQRRCAGYASCADVLQKQLSQAKSAVPEDRDYVINVLGRNVSVYCHGMRSGNPVEYLTLSKDTENYSEIYEQRL… |
| V4ARX2 | 1-173 | None |
| P59511 | 1707-1905 | None |
| B4DTT6 | 616-835 | None |
| C3ZH52 | 110-291 | None |
| A0A3A5G9E8 | 785-980 | None |
| A0A6P8SWV9 | 32-178 | None |
| A0A564XZT5 | 153-367 | None |
| A0A2S9Y2Q8 | 114-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.