DPCstruct | MC990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317JAW8 | 159-269 | GVPSSDRATLTQYWIRRGDYLTWVTIAYDPVYLTEPMIRSSEYRLALNQQIPPYPCDAVEEVVRAKGVVPHELPGKNAFMGEFGKKY… |
| A0A2V8H0X8 | 10-130 | RRWGPMRSDDATVRIRYKRIGNNYLRATVIIYDPVYMTEPYIRTSLIWALDPNLVLPPYPCEEATESVVEHGSVPHYLPGKSLLPAQ… |
| A0A2V8KUD5 | 184-315 | None |
| A0A2V8JQ74 | 78-203 | None |
| A0A2E2HEC8 | 39-162 | None |
| A0A2V8IHD9 | 183-298 | None |
| A0A317IZU6 | 19-126 | None |
| A0A2A5C743 | 33-158 | None |
| A0A2V8MXB0 | 48-190 | None |
| A0A1F2RJ33 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.