DPCstruct | MC99
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0YYU7 | 9-125 | SDVEWTSDALERLQRVPVGMARDMTRQRVEALAVEQGKSSVTPDMIEAKYHQWGEGSAKASSELVWTDAASERVQRIPKFVRGMVVK… |
| A0A535UCB6 | 102-226 | AEFTWTVEAEARLAEVPEFCRDLTRWRVEWTAHKLGLGTTITPEVMQVKYEMWGKVSHNIREREREGLPWTDGALARFARIPDFVQG… |
| A0A2D6FWE9 | 563-691 | None |
| A0A3D5W9T7 | 40-166 | None |
| A0A535Q8Q6 | 314-430 | None |
| A0A2D5UDZ2 | 136-269 | None |
| A0A2E2NRT4 | 863-982 | None |
| A0A836UF05 | 51-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.