DPCstruct | MC9898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 258 ± 19 aa |
| Standard deviation of domain lengths | 19.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H8TNA5 | 1-268 | MPVPNEILQLVNNLKDFLKQQKTMSTELARMSSKGSNEVAGDITMCQKNLQFIEHNLDKQKTSVEKLKYETNKCLQDFEIAQRNHDH… |
| A0A6L2PF93 | 378-606 | VKTQKGLSSDIARGSVKPLHKVQEDTESLKQMLAGLTSGFQRNVALADKLKADTAKCLHHAEMAQRTHELPPGLQYDNVAPIEYFTE… |
| R7TAY8 | 2-240 | None |
| U4UDV6 | 543-777 | None |
| A0A8B6FCJ9 | 327-601 | None |
| A0A653BV98 | 1-231 | None |
| J9K2Y0 | 181-429 | None |
| K9J1P0 | 234-506 | None |
| A0A3N0Y943 | 243-527 | None |
| A0A2C9LKK6 | 139-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.