DPCstruct | MC9897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9KRB6 | 1-76 | CIHCICLHESGCKAIGCEMDVGSLSCGYYQIKLPYYEDCGTPGRKSGEDVTTAWKRCADDYTCSTQCVNAYVNRYK |
| A0A2H8TMH5 | 24-109 | QEEFPPGWTEKCIGCMCEASSGCNQTLECIEQNEVKYCGVFLLSDVYWQDAGTPVLQGDDPTRIGAFERCVRDPYCAARAVNQYIQ |
| A0A443RB68 | 219-334 | None |
| A0A0N1IPP7 | 112-187 | None |
| T1GX33 | 1-79 | None |
| A0A2A2KRX4 | 1-66 | None |
| A0A4Y2D1Z1 | 6-104 | None |
| A0A0N4VVZ6 | 1-87 | None |
| A0A6V7WLQ1 | 51-151 | None |
| A0A0M3ILG9 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.