DPCstruct | MC9896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Standard deviation of domain lengths | 23.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183JFY6 | 3-140 | SSTLYQKLSRYLPYSKCRNEGCKCSTWKLSDNAIDEKLVEAICENCCHVHYSLSDPNESTWLNSAMQMVDDVERMYILCTKEEDYET… |
| A0A2H8TLU0 | 18-199 | QVEPKELLLMNNIWKTNDILYKRIRMEREKLEDKKSGSLVRIVAEFSPCKASGCRCKKGVFDEVECDNHGWKNSICTRAGCKHPLSD… |
| A0A090LK47 | 20-187 | None |
| A0A5S6Q3F1 | 1-168 | None |
| A0A6P8H9H9 | 1-205 | None |
| B7PUT4 | 1-203 | None |
| A0A834JN25 | 27-221 | None |
| A0A6J3HZ28 | 55-245 | None |
| A0A0N1ISX5 | 23-211 | None |
| A0A834FP15 | 31-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.