DPCstruct | MC9895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.97 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF06586- PF11920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7X9V6 | 5-98 | GVSQVQVSNRPVVGLVRGALVETVPMGQWRSAGLYVTAVRITNKSKQPLEIPLDNLRGKWIAVTAQHGRLGAAGSETDTSALYLICD… |
| A0A0C3N9A5 | 249-344 | TAGVTQVAVQTNPIPGLLRGTSVEAVPLGQWRSANLSVTAVRITNLSRFALEIPLEQVRGRWIAATAQHGRIGPAGSDTDTTAIYLV… |
| A0A656GQY5 | 190-298 | None |
| A0A3A5FFC6 | 26-173 | None |
| K2D8D2 | 21-120 | None |
| A0A377F4J9 | 79-191 | None |
| A0A377HFW7 | 57-169 | None |
| A0A1Y5H177 | 562-672 | None |
| A0A380BVL1 | 3-130 | None |
| A0A5N9VYZ4 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.