DPCstruct | MC9892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 13 aa |
| Standard deviation of domain lengths | 12.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 63.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 50.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7YQT8 | 1-92 | MASPYGRSVVPWASSAGGKMHSFQHPVRLFWPKSKSFDYLYSDGEVLLRNLPVQATISFYDESDSEDDEDDEEWDEEDHSDSGSCRK… |
| A0A6P7XK85 | 76-141 | AGGKLPHYQHPVRLFWPKSKCYDYLYQEAEVLLKNFPVQATIAFYEDSDSDSDDSDVEHDSGIESD |
| P57055 | 54-159 | None |
| A0A2J8M7P3 | 68-156 | None |
| F1QN21 | 50-133 | None |
| A0A212C7Y4 | 1-70 | None |
| A0A7J7FHE3 | 42-120 | None |
| F1PDT9 | 118-219 | None |
| A0A4W5NU12 | 135-219 | None |
| A0A401S1U3 | 69-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.