DPCstruct | MC989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6CHT2 | 2-68 | KIACPKCNWEPDGKAYWVCSDCGTIWDTFSTAARCPSCKRQYKITACVPEAGGCHEASPHLDWYTDL |
| A0A2V8H031 | 1-74 | MRCPLCGWRPSASSRWCCDSVDGPEPPFDSCGTIWNTFSTRGRCPGCGHQWKWTSCLRCHEWSPHDDWYEKADG |
| A0A0N1B6X6 | 6-83 | None |
| A0A7C5J555 | 410-477 | None |
| A0A661NJA2 | 281-345 | None |
| A0A4E0QW72 | 10-77 | None |
| A0A7W1AIA6 | 1-60 | None |
| A0A7Y5RZR6 | 7-69 | None |
| A0A7C1J090 | 2-70 | None |
| A0A1C4EM99 | 38-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.