DPCstruct | MC9889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 149 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20811 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843WU97 | 1-151 | MESRGDLASILPYMPVILRSSSLFWPPNAHEALKGLSLGPDVSGVVSGEVLFDAIVDLRASLGLSRERLAFRAAQGYATFFDELMTR… |
| A0A834GIH3 | 1-179 | MEDREDLRSLLPYLPVVSRSSSLFWPSQVVEALKALSGGPHHSRVDSGEVLFLAIADLRQSLSLTQFSDSLAFAAADGYSLFFDDVN… |
| A0A7J7L4G2 | 1-146 | None |
| A0A803M5H1 | 1-158 | None |
| A0A817AP35 | 12-162 | None |
| I1I6Z4 | 89-232 | None |
| A0A6G1EXB6 | 68-203 | None |
| A0A811QXR4 | 1-128 | None |
| A0A498HTZ3 | 5-158 | None |
| A0A067DW21 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.