DPCstruct | MC9888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 186 ± 23 aa |
| Standard deviation of domain lengths | 22.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3WS85 | 109-248 | SAEVCITHIRSLIGYFDLDPNRVLDIILDVFEIRRNAFSLFIELLTLYQPDKTDLTHILGHKFHFYQERDSITPESLHRLAALLVSY… |
| A0A834GD40 | 29-199 | IGHFDLDPNRVFDIVLECFELQPDNCVFLDLIPIFPKSHASQILGFKFQYYQRMEVNHHVSLGLYQLTALLVKEDFIDLDSIYAHLL… |
| A0A7J6ARL6 | 177-353 | None |
| A0A444TGW7 | 129-319 | None |
| A0A6J0YTY1 | 180-358 | None |
| A0A5E4PT40 | 175-376 | None |
| A0A287MBR2 | 32-243 | None |
| A0A183EDJ5 | 1-201 | None |
| A0A423T6H5 | 47-243 | None |
| A0A0N4UJR9 | 84-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.