DPCstruct | MC9884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 70.02 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0036- PF02792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F4WKM2 | 47-108 | KEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCL |
| A0A834G1C0 | 210-272 | NEGRYNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQVLKCF |
| A0A7M3R3K4 | 72-122 | None |
| A0A364N3P4 | 79-147 | None |
| A0A5J4NUD1 | 120-194 | None |
| A0A218WS01 | 130-190 | None |
| A0A2D0QJC3 | 45-92 | None |
| A0A094B3Y9 | 83-140 | None |
| H3EEF8 | 731-800 | None |
| A0A5J5C3I6 | 640-700 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.