DPCstruct | MC9883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 171 ± 29 aa |
| Standard deviation of domain lengths | 28.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A193C6W2 | 34-187 | GGLDVIEHVVVFMQENRSFDHYLGTLRGVRGFGDPAAIKLPSGASVFQQPDGTGTLLPYAIDDQFMADVDHSWSGGHRAWNKGRHDG… |
| A0A834FYR9 | 33-191 | SSSPIKTIVVVVMENRSFDHMLGWMKKLNPKINGVTGSESNPLSTTDPTSPLLYFRNQAHYVDPDPGHSFQAIREQIFGSNDTSANP… |
| A0A2S6H3W9 | 59-192 | None |
| A0A2V7W5E9 | 2-178 | None |
| J3GIQ7 | 16-209 | None |
| A0A535VNV4 | 129-281 | None |
| A0A2R6CDM1 | 235-375 | None |
| A0A4Y7J1I0 | 6-172 | None |
| A0A2N3DH19 | 14-196 | None |
| A0A4V3WMH2 | 12-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.