DPCstruct | MC9882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00954 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5XT94 | 167-254 | WPKTSSVYWPKTDGTVFDSGRTPYNSSRLAISDKAGQFISSDNLMFNASDYGIGPKRRLTMDYDGILRLYSLDESTGVWVLKSLEIQE |
| A0A811RIY8 | 273-362 | YDGPDISNLYWSNPDFSSWLNYRISYNGSRRGVLDNLGQFTASDNTSFVSADWGPGIKRRLTLDYDGDLRLYSLNDSDGSWSVSWMA… |
| A0A7J0GHG3 | 202-289 | None |
| A0A7J8QJQ6 | 1-91 | None |
| A0A2N9H4Q3 | 96-184 | None |
| A0A834LID2 | 54-138 | None |
| A0A2P5XWX8 | 197-284 | None |
| B9R757 | 150-237 | None |
| A0A2N9G6X4 | 7-97 | None |
| A0A7J9M625 | 85-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.