DPCstruct | MC9881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401G2N7 | 1-88 | MHPACDMLKNVRFAGNLIPHSFYKHIRRESGTTDFEGVGIMSDILYHYRPAEIRDRKTGRVTGYRQRFRGDKFQISYRQYAEHYGIST |
| A0A1B1L942 | 1-86 | MNSNVIQVARINLQGNTLDQGWFKYLTLENGKPYMVAITILSEIFYWYKPTEIKDERTNEIQYKQKFKADKLQKSYQQLADSFGFT |
| A7C1I0 | 3-90 | None |
| A0A285BGB1 | 1-87 | None |
| A0A0Q5L3V1 | 2-95 | None |
| A0A0U5JFT4 | 2-91 | None |
| A0A2V5VGY4 | 1-82 | None |
| A0A3B0J8E8 | 1-75 | None |
| A0A401G2M5 | 1-87 | None |
| A0A1C0A7T6 | 7-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.