DPCstruct | MC988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 113 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.67 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0177- CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8GV36 | 46-148 | TVATAAVLFALATAGIGAGTRNTIVIGSKNFTEQVVLGELLAQTLERRGVTVTRRLNLGGSFICDRAIRSGDIDAYVEYTGTALAAI… |
| A0A7R7DJ83 | 86-262 | SAALDTPKLIQLNKQADVDRVPPQKVAANFAKSANLTSGVQKGSGSVTIGAANFSENKTLAYLYKTVLDAGGFKTSVRTIGNRELYE… |
| A0A2N9NE97 | 12-130 | None |
| A0A812S1N9 | 707-800 | None |
| A0A550IHH0 | 20-108 | None |
| A0A1G9Z6E9 | 101-252 | None |
| A0A6N8V5B3 | 143-254 | None |
| A0A2V7WV34 | 349-467 | None |
| A0A6L9J1H2 | 28-140 | None |
| A0A2E3ENX7 | 215-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.