DPCstruct | MC9876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9TTX5 | 55-172 | NLWIVTTEAYPETANLDSIVIATFGPNYRVADWNDLVDYSLTHSIEEWADSIGMQNGDGDYYITRDGNHFWNKTNRHYYIARHDHIV… |
| Q23AY8 | 95-215 | FKLTKLAYDLSVANYEDVCFKNFGSEFRVAEWTDLEDIFYDLEEAKIDNFVEYLGFNNSQNDFAIKYNGNHKYSQSRFYFVSWHNHK… |
| A0A496AY68 | 44-184 | None |
| A0A522FP84 | 10-144 | None |
| A0A7S3TLR1 | 10-148 | None |
| A0A2W1B3U3 | 429-544 | None |
| A0A7Y8TI71 | 8-148 | None |
| U5Q6U5 | 3-124 | None |
| A0A7C4RV36 | 8-102 | None |
| A0A7S4WEH5 | 62-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.