DPCstruct | MC9875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 152 ± 20 aa |
| Standard deviation of domain lengths | 20.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q23JD1 | 91-231 | VSTAVAGTNVACQQGNACTTNTCGALPSPAFTWSKASDANNCFITSCLSAPMPNSGLTDNFCNSCQSTNKFANAYGTACVNPANGSC… |
| Q23CN8 | 4-140 | KYIIAQILTFTQVFSQIPGAEVTCSSSSCSTSCPAAAGFTWTQSRDNPNLCIISDCTNYSATSKTQTGLSDLFCLSCLSQTNNSQYS… |
| I7MLI9 | 2-138 | None |
| Q23H97 | 3-157 | None |
| Q22ZE0 | 4-135 | None |
| Q22TF4 | 1-178 | None |
| Q235S6 | 367-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.