DPCstruct | MC9873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Standard deviation of domain lengths | 18.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q23G71 | 250-375 | VEGCIQCDANQNCLKCEVNLQLSQENNKCFLKQNFCESSVEFIESPFTKNQCSKICSSFTYQNFETHQCEQTQQCPYFQSSFDNFNQ… |
| Q22WS8 | 1-160 | MMIKYITVKVILFLVIQLKAKELCTEIEGCLSCTNNANNQNQCTQCDMDYQLDQKQNVCIYIKCNNYQFYDKNQHDGTQESGCVAIC… |
| I7M7G8 | 89-217 | None |
| W7XCT1 | 3-141 | None |
| W7X9T1 | 5-131 | None |
| Q24GC5 | 92-209 | None |
| Q24GC3 | 87-203 | None |
| Q22P70 | 33-145 | None |
| Q23H57 | 51-218 | None |
| Q22NM2 | 80-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.