DPCstruct | MC9870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0407 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6M1U6 | 1-64 | MNISLNFSEQEKKTVKEYLAGFEALETKTQYEDVRVKIGESVVTLYTSGKLLIQGEDAEKTKDI |
| A0A1F1LSC3 | 1-64 | MASVTLQLDAASRAQMKASYVDHLLDPVPHSEFRAQVDGVTITAYASGKVLFQGKDVEAQVARW |
| A0A091CCN8 | 1-74 | None |
| A0A6A4UN59 | 1-63 | None |
| A0A6M2A7L8 | 1-65 | None |
| A0A3D1TFS4 | 113-175 | None |
| A0A354LWE9 | 1-71 | None |
| W1Q242 | 1-67 | None |
| J1DJU4 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.