DPCstruct | MC987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 43.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8GUA0 | 1-71 | MALRDQLERLVDEMVTKGIRYDEAQREFEKKFIVQVLAKADGNLCKAADLLGIHRNTLSRKMTEYRLRPSA |
| A0A2G4JI46 | 2-62 | VVEMVTRGVHYTDAQREFDKRFISCVIEKHDGNLCKAADTLGVHRNTLTRKTKQLQIRVRA |
| A0A3N5LYD6 | 15-78 | None |
| A0A2V8ZLS4 | 1-75 | None |
| A0A3E0NNZ5 | 25-90 | None |
| A0A2V9L5L7 | 1-66 | None |
| Q1ILQ9 | 7-73 | None |
| A0A2V9UZF0 | 1-70 | None |
| A0A2V8H1F6 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.