DPCstruct | MC9868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 223 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4Q7J5 | 14-269 | LISRMAFLNQFHLFTCKTPQSPQQFLYFFYVNYIIHELKAHALVEWSWLLLRKFGRGGSIEEEQASRAAYKRRTEGTLPKIKVLMSQ… |
| A0A7M7QLI7 | 7-241 | SAHHEIKRLYQMVTIAEIKNLLMAQFAYATQNLLNKKPGGNVNELKNVVDKFSRRTSRMTAAFKNAMIKAPRDFWYCDPDEHAEGST… |
| A0A5E4Q6X5 | 371-544 | None |
| A0A1B6KBP6 | 172-395 | None |
| T1GYM7 | 28-256 | None |
| A0A835CSL2 | 205-463 | None |
| A0A835CKM8 | 190-428 | None |
| A0A834XMP7 | 278-547 | None |
| A0A6P5VEG3 | 195-430 | None |
| A0A5E4Q8A6 | 371-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.