DPCstruct | MC9866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 19.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.90 |
| Pfam Score | 98.51 |
| Assigned Pfam label(s) | PF03645- CL0257- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7Q595 | 15-136 | IDQIAKYQNSYRLESRNVFKLETVDKLVETIMNENLENFTYEPKEAVKICTETASEIQRKIRVLNFDRYKIGVTVSIVEKASQSMDS… |
| A0A433SL76 | 2-102 | AHKVEEAMKEVLQARLTGMDYDHASCNMLSKELVADIHRKVKEFAWKRYRLVCHVTLGQDCGQGVQVASRCVWDAKNDNYACVRFSN… |
| A0A7J6KWX4 | 2-133 | None |
| A0A2B4SSZ8 | 83-209 | None |
| A0A7S2IXU3 | 7-126 | None |
| A0A1V8SUN7 | 1-126 | None |
| A0A2R8ZM92 | 3-120 | None |
| A0A504X538 | 3-113 | None |
| A0A7M5UZ53 | 145-270 | None |
| A0A4C1UN43 | 18-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.